Edit |   |
---|---|
Antigenic Specificity | STAT6 |
Clone | polyclonal |
Host Species | n/a |
Reactive Species | rat. predicted to work with: human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Description: Rabbit IgG polyclonal antibody for Signal transducer and activator of transcription 6(STAT6) detection. Tested with WB in Human;Rat. Background: STAT6 is a human gene. The protein encoded by this gene is a member of the STAT family of transcription factors. The gene spans 19 kb and contains 23 exons. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human STAT6(85-115aa ESIYQRDPLKLVATFRQILQGEKKAVMEQFR), different from the related mouse sequence by three amino acids. Ig Type: Rabbit IgG |
Other Names | [Signal transducer and activator of transcription 6; D12S1644; IL 4 STAT; IL-4 Stat; IL4 STAT; Interleukin 4 Induced; Interleukin 4 Induced Transcription Factor IL4 STAT; Signal transducer and activator of transcription 6; Signal Transducer And Activator Of Transcription 6 Interleukin 4 Induced; Signal Transducer And Activator Of Transcription 6 Nirs Variant 1; Signal transducer and activator of transcription 6, interleukin 4 induced; STAT 6; STAT interleukin4 induced; STAT, interleukin4 induced; Stat6; STAT6_HUMAN; STAT6B; STAT6C; Transcription factor IL 4 STAT; signal transducer and activator of transcription 6, interleukin-4 induced], [STAT6; STAT6; STAT6B; STAT6C; D12S1644; IL-4-STAT] |
Gene, Accession # | [STAT6], Gene ID: 6778, NCBI: NP_001171549.1, UniProt: P42226 |
Catalog # | MBS177998 |
Price | $280 |
Order / More Info | STAT6 Antibody from MYBIOSOURCE INC. |
Product Specific References | 1. Dickensheets, H. L., Venkataraman, C., Schindler, U., Donnelly, R. P.Interferons inhibit activation of STAT6 by interleukin 4 in human monocytes by inducing SOCS-1 gene expression.Proc. Nat. Acad. Sci. 96: 10800-10805, 1999. 2. Duetsch, G., Illig, T., Loesgen, S., Rohde, K., Kloop, N., Herbon, N., Cohlke, H., Altmueller, J., Wjst, M.STAT6 as an asthma candidate gene: polymorphism-screening, association and haplotype analysis in a Caucasian sib-pair study.Hum. Molec. Genet. 11: 613-621, 2002. 3. Mullings, R. E., Wilson, S. J., Puddicombe, S. M., Lordan, J. L., Bucchieri, F., Djukanovic, R., Howarth, P. H., Harper, S., Holgate, S. T., Davies, D. E.Signal transducer and activator of transcription 6 (STAT-6) expression and function in asthmatic bronchial epithelium.J. Allergy Clin. Immun. 108: 832-838, 2001. |