Edit |   |
---|---|
Antigenic Specificity | SLC22A13 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: SLC22A13 antibody was raised against the N terminal of SLC22A13. Rabbit polyclonal SLC22A13 antibody raised against the N terminal of SLC22A13 |
Immunogen | Immunogen: SLC22A13 antibody was raised using the N terminal of SLC22A13 corresponding to a region with amino acids FFAHVFMVLDEPHHCAVAWVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLM |
Other Names | [SLC22A13; SLC22A13; OCTL1; OCTL3; ORCTL3; SLCA13-22; SLCA13 22; Solute Carrier Family 22 Member 13; SLC22A13] |
Gene, Accession # | [SLC22A13], Gene ID: 9390, NCBI: NP_004247.2 |
Catalog # | MBS5300736 |
Price | $430 |
Order / More Info | SLC22A13 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |