Iba1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Iba1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Iba1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Allograft inflammatory factor 1(AIF1) detection. Background: Allograft inflammatory factor 1 (AIF-1), also known as ionized calcium-binding adapter molecule 1(IBA1), is a protein that in humans is encoded by the AIF1 gene. This gene encodes a protein that binds actin and calcium. And this gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Iba1 (99-133aa ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids. |
| Other Names | [AIF 1; AIF-1; AIF1 protein; allograft inflammatory factor 1; G1; IBA1; IBA 1; Iba1; P55008; Allograft inflammatory factor 1], [AIF1; AIF1; IBA1; IRT1; AIF-1; IRT-1; G1; IBA1; AIF-1] |
| Gene, Accession # | [AIF1], Gene ID: 199, NCBI: NP_001305899.1, UniProt: P55008 |
| Catalog # | MBS178646 |
| Price | $315 |
| Order / More Info | Iba1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: AIF1 allograft inflammatory factor 1.2. Utans U, Arceci RJ, Yamashita Y, Russell ME (June 1995). Cloning and characterization of allograft inflammatory factor-1: a novel macrophage factor identified in rat cardiac allografts with chronic rejection. J. Clin. Invest. 95 (6): 2954-62.3. Tian Y, Jain S, Kelemen SE, Autieri MV (February 2009). AIF-1 expression regulates endothelial cell activation, signal transduction, and vasculogenesis. Am. J. Physiol., Cell Physiol. 296 (2): C256-66. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies