Edit |   |
---|---|
Antigenic Specificity | EXOSC6 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, dog |
Isotype | n/a |
Format | Protein A purified |
Size | 0.1 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB), Immunohistochemistry (IHC) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: EXOSC6 antibody was raised against the N terminal of EXOSC6. EXOSC6 constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. The composition of human exosome is similar to its yeast counterpart. This protein is homologous to the yeast Mtr3 protein. Its exact function is not known, however, it has been shown using a cell-free RNA decay system that the exosome is required for rapid degradation of unstable mRNAs containing AU-rich elements (AREs), but not for poly(A) shortening. |
Immunogen | Immunogen: EXOSC6 antibody was raised using the N terminal of EXOSC6 corresponding to a region with amino acids MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAK |
Other Names | [Rabbit EXOSC6 raised against the N terminal of EXOSC6; EXOSC6; EXOSC6; EXOSC 6; EXOSC 6; EXOSC-6; EXOSC6; Exosome Component 6; EXOSC-6] |
Gene, Accession # | [EXOSC6] |
Catalog # | MBS5313084 |
Price | $400 |
Order / More Info | EXOSC6 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |