Edit |   |
---|---|
Antigenic Specificity | IFNGR1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit IgG polyclonal antibody for Interferon gamma receptor 1(IFNGR1) detection. Background: Interferon gamma receptor 1 (IFNGR1), also known as CD119 (Cluster of Differentiation 119), is a protein that in humans is encoded by the IFNGR1 gene. This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection. |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IFNGR1 (443-484aa QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED), different from the related mouse sequence by seventeen amino acids. |
Other Names | [CD 119; CD119; CDw119; IFN gamma R1; IFN-gamma-R1; IFNG R1; IFNGR 1; IFNGR; IFNGR1; IMD27A; IMD27B; P15260; Interferon gamma receptor 1], [IFNGR1; IFNGR1; CD119; IFNGR; IMD27A; IMD27B; IFN-gamma-R-alpha] |
Gene, Accession # | [IFNGR1], Gene ID: 3459, NCBI: NP_000407.1, UniProt: P15260 |
Catalog # | MBS178653 |
Price | $315 |
Order / More Info | IFNGR1 Antibody from MYBIOSOURCE INC. |
Product Specific References | 1. Entrez Gene: IFNGR1 interferon gamma receptor 1.2. Aguet M, Dembi? Z, Merlin G (Oct 1988). Molecular cloning and expression of the human interferon-gamma receptor. Cell. 55 (2): 273-80.3. Novick D, Orchansky P, Revel M, Rubinstein M (Jun 1987). The human interferon-gamma receptor. Purification, characterization, and preparation of antibodies. The Journal of Biological Chemistry. 262(18): 8483-7. |