CHAT Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-CHAT antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | CHAT |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Choline O-acetyltransferase(CHAT) detection. Background: Choline acetyltransferase (commonly abbreviated as ChAT, but sometimes CAT) is a transferase enzyme responsible for the synthesis of the neurotransmitter acetylcholine. In humans, the choline acetyltransferase enzyme is encoded by the CHAT gene. This gene product is a characteristic feature of cholinergic neurons, and changes in these neurons may explain some of the symptoms of Alzheimer's disease. Polymorphisms in this gene have been associated with Alzheimer's disease and mild cognitive impairment. Mutations in this gene are associated with congenital myasthenic syndrome associated with episodic apnea. Multiple transcript variants encoding differen |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CHAT (177-213aa ETLQQKLLERQEKTANWVSEYWLNDMYLNNRLALPVN), different from the related mouse and rat sequences by one amino acid. |
| Other Names | [ChAT; CHOACTase; Choline acetylase; choline acetyltransferase; Choline O acetyltransferase; CMS1A; CMS1A2; CMS6; P28329; Choline O-acetyltransferase], [CHAT; CHAT; CMS6; CMS1A; CMS1A2; CHOACTASE; CHOACTase; ChAT; Choline acetylase] |
| Gene, Accession # | [CHAT], Gene ID: 1103, NCBI: NP_001136401.1, UniProt: P28329 |
| Catalog # | MBS178638 |
| Price | $280 |
| Order / More Info | CHAT Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Berman R, Wilson IB, Nachmansohn D (September-October 1953). Choline acetylase specificity in relation to biological function.. Biochimica et Biophysica Acta. 12 (1-2): 315-24.2. Strauss WL, Kemper RR, Jayakar P, Kong CF, Hersh LB, Hilt DC, Rabin M (February 1991). Human choline acetyltransferase gene maps to region 10q11-q22.2 by in situ hybridization. Genomics. 9 (2): 396-8. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies