Edit |   |
---|---|
Antigenic Specificity | HTRA1/Htra Picoband |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 0.1 mg |
Concentration | n/a |
Applications | Immunohistochemistry (IHC), Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Description: Serine protease HTRA1 is an enzyme that in humans is encoded by the HTRA1 gene. This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. It has also been suggested to be a regulator of cell growth. Variations in the promoter region of this gene are the cause of susceptibility to age-related macular degeneration type 7. Protein Function: Serine protease with a variety of targets, including extracellular matrix proteins such as fibronectin. HTRA1-generated fibronectin fragments further induce synovial cells to up-regulate MMP1 and MMP3 production. May also degrade |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human HTRA1 (QLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIAD). Subcellular Localization: Cell membrane. Tissue Specificity: Widely expressed, with strongest expression in placenta (at protein level). Secreted by synovial fibroblasts. Up- regulated in osteoarthritis and rheumatoid arthritis synovial fluids and cartilage as compared with non-arthritic (at protein level). |
Other Names | [Serine protease HTRA1; High-temperature requirement A serine peptidase 1; L56; Serine protease 11; HTRA1; HTRA; PRSS11] |
Gene, Accession # | [HTRA1], Gene ID: 5654, NCBI: NP_002766.1, UniProt: Q92743 |
Catalog # | MBS1750719 |
Price | $315 |
Order / More Info | HTRA1/Htra Picoband Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |