Edit |   |
---|---|
Antigenic Specificity | LIFR |
Clone | polyclonal |
Host Species | n/a |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Description: Rabbit IgG polyclonal antibody for Leukemia inhibitory factor receptor(LIFR) detection. Tested with WB in Human. Background: LIFR also known as CD118 (Cluster of Differentiation 118), is a subunit of a receptor for leukemia inhibitory factor. This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A tra |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human LIFR(863-899aa EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE), different from the related mouse and rat sequences by one amino acid. Ig Type: Rabbit IgG |
Other Names | [Leukemia inhibitory factor receptor; CD118; CD118 antigen; FLJ98106; FLJ99923; Leukemia inhibitory factor receptor alpha; Leukemia inhibitory factor receptor; LIF R; LIF receptor; LIF-R; Lifr; LIFR_HUMAN; SJS2; STWS; SWS; leukemia inhibitory factor receptor alpha], [LIFR; LIFR; SWS; SJS2; STWS; CD118; LIF-R; LIF receptor; LIF-R] |
Gene, Accession # | [LIFR], Gene ID: 3977, NCBI: NP_001121143.1, UniProt: P42702 |
Catalog # | MBS177717 |
Price | $280 |
Order / More Info | LIFR Antibody from MYBIOSOURCE INC. |
Product Specific References | 1. Entrez Gene: LIFR leukemia inhibitory factor receptor alpha. 2. Lass A, Weiser W, Munafo A, Loumaye E (2002). Leukemia inhibitory factor in human reproduction. Fertil. Steril. 76 (6): 1091-6. 3. Tomida M (2003). Structural and functional studies on the leukemia inhibitory factor receptor (LIF-R): gene and soluble form of LIF-R, and cytoplasmic domain of LIF-R required for differentiation and growth arrest of myeloid leukemic cells.. Leuk. Lymphoma 37 (5-6): 517-25. |