Edit |   |
Antigenic Specificity | ITGA2B |
Clone | polyclonal |
Host Species | n/a |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 mg |
Concentration | n/a |
Applications | n/a |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for Integrin alpha-Iib(ITGA2B) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: Integrin alpha-IIb is a protein that in humans is encoded by the ITGA2B gene. It is mapped to 17q21.32. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 2b undergoes post-translational cleavage to yield disulfide-linked light and heavy chains that join with beta 3 to form a fibrinogen receptor expressed in platelets that plays a crucial role in coagulation. Mutations that interfere with this role result in thrombasthenia. In addition to adhesion, integrins are known to participate in cell |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ITGA2B (677-711aa EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN), different from the related mouse sequence by four amino acids. Ig Type: Rabbit IgG |
Other Names | [Integrin alpha-Iib; antigen CD41; BDPLT16; BDPLT2; CD41; CD41B; form 2; GP2B; GPalpha IIb; GPIIb; GT; GTA; HPA3; Integrin alpha 2b; Integrin alpha IIb; Integrin alpha-IIb light chain; Integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); ITA2B_HUMAN; ITGA2B; ITGAB; platelet fibrinogen receptor, alpha subunit; platelet glycoprotein IIb of IIb/IIIa complex; Platelet membrane glycoprotein IIb; platelet specific antigen BAK; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)], [ITGA2B; ITGA2B; GT; GTA; CD41; GP2B; HPA3; CD41B; GPIIb; BDPLT2; BDPLT16; PPP1R93; GP2B; ITGAB; GPIIb] |
Gene, Accession # | [ITGA2B], Gene ID: 3674, NCBI: NP_000410.2, UniProt: P08514 |
Catalog # | MBS178307 |
Price | $315 |
Order / More Info | ITGA2B Antibody from MYBIOSOURCE INC. |
Product Specific References | 1. Entrez Gene: ITGA2B integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41). 2. Naik UP, Parise LV (1997). Structure and function of platelet alpha IIb beta 3.. Curr. Opin. Hematol. 4(5): 317-22. 3. Quinn MJ, Byzova TV, Qin J et al. (2004). Integrin alphaIIbbeta3 and its antagonism.. Arterioscler. Thromb. Vasc. Biol. 23 (6): 945-52. |