Edit |   |
---|---|
Antigenic Specificity | Kir1.1 (ROMK1) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mL |
Concentration | 1ug/ul |
Applications | Western Blot (WB), Immunohistochemistry (IHC) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: Mouse-identical, human-45/50 residues identical. Inwardly rectifying K+ channel 1, Kcnj1 Kir1.1 (ROMK1) was the first member of the family of inward rectifying K+ channels to be cloned.1 The family includes 15 members that are structurally and functionally different from the voltage-dependent K+ channels. The family's topology consists of two transmembrane domains that flank a single and highly conserved pore region with intracellular N-and C-termini. As is the case for the voltage-dependent K+ channels the functional unit for the Kir channels is composed of four subunits that can assembly as either homo or heterotetramers. Kir channels are characterized by a K+ efflux that is limited by depolarizing membrane potentials thus ma |
Immunogen | Immunogen: GST fusion protein with sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 of rat ROMK1 (Accession P35560). |
Other Names | [K ir1-1 (ROMK1)] |
Gene, Accession # | [Kir1.1] |
Catalog # | MBS4159229 |
Price | $725 |
Order / More Info | Kir1.1 (ROMK1) Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |