PAR2 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-PAR2 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | PAR2 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Proteinase-activated receptor 2(F2RL1) detection. Tested with WB in Human. Background: Protease activated receptor 2 (PAR2), also known as coagulation factor II (thrombin) receptor-like 1(F2RL1) or G-protein coupled receptor 11 (GPR11), is a protein that in humans is encoded by the F2RL1 gene. F2RL1 is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. F2RL1 is also a member of the protease-activated receptor family. It is activated by trypsin, but not by thrombin. It is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. The F |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PAR2 (349-383aa HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids. Ig Type: Rabbit IgG |
| Other Names | [Proteinase-activated receptor 2; Coagulation factor II receptor like 1; Coagulation factor II receptor-like 1; Coagulation factor II thrombin receptor like 1; F2RL1; G protein coupled receptor 11; G-protein coupled receptor 11; GPR11; PAR 2; PAR-2; PAR2_HUMAN; Protease activated receptor 2; Proteinase activated receptor 2; Proteinase-activated receptor 2; Thrombin receptor like 1; Thrombin receptor-like 1; coagulation factor II (thrombin) receptor-like 1], [F2RL1; F2RL1; PAR2; GPR11; GPR11; PAR2; PAR-2] |
| Gene, Accession # | [PAR2], Gene ID: 2150, NCBI: NP_005233.3, UniProt: P55085 |
| Catalog # | MBS177710 |
| Price | $280 |
| Order / More Info | PAR2 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Kawabata A (2004). PAR-2: structure, function and relevance to human diseases of the gastric mucosa. Expert Reviews in Molecular Medicine 4(16): 1-17. 2. Lee SE, Jeong SK, Lee SH (November 2010). Protease and protease-activated receptor-2 signaling in the pathogenesis of atopic dermatitis. Yonsei Med. J. 51 (6): 808-22. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies