Edit |   |
---|---|
Antigenic Specificity | PLP1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat, dog |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal PLP1 antibody |
Immunogen | Immunogen: PLP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGAL |
Other Names | [PLP1; PLP1; PLP/DM20; Pelizaeus-Merzbacher Disease Spastic Paraplegia 2 Uncomplicated; SPG2; PLP; PMD; PLP 1; PLP1; PLP-1; Proteolipid Protein 1; MMPL], [PLP1; PLP1; PLP; PMD; HLD1; MMPL; SPG2; GPM6C; PLP/DM20; PLP; PLP] |
Gene, Accession # | [PLP1], Gene ID: 5354, NCBI: CAG38779.1, UniProt: P60201 |
Catalog # | MBS839777 |
Price | $430 |
Order / More Info | PLP1 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |