TGFBR1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-TGFBR1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | TGFBR1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for TGF-beta receptor type-1(TGFBR1) detection. Background: Transforming growth factor, beta receptor I is a TGF beta receptor. TGFBR1 is its human gene. The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). TGFB1 regulates cell cycle progression by a unique signaling mechanism that involves its binding to TGFBR2 and activation of TGFBR1. Both are transmembrane serine/threonine receptor kinases. The TGFBR1 receptor may be inactivated in many of the cases of human tumor cells refractory |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR1 (149-186aa HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT), identical to the related mouse and rat sequences. |
| Other Names | [AAT5; ALK 5; ALK5; ALK-5; MSSE; SKR 4; SKR4; TbetaR I; TbetaR-I; tgf b receptor i; TGF beta Receptor I; TGF beta receptor type 1; TGF beta receptor type I; TGF beta type I receptor; TGF-beta receptor type I; TGF-beta receptor type-1; TGF-beta type I receptor; TGFBR 1; TGFBR1 protein; TGFR 1; TGFR1; TGFR-1; P36897; transforming growth factor, beta receptor 1], [TGFBR1; TGFBR1; AAT5; ALK5; ESS1; LDS1; MSSE; SKR4; ALK-5; LDS1A; LDS2A; TGFR-1; ACVRLK4; tbetaR-I; ALK5; SKR4; TGFR-1; ALK-5; ALK5; SKR4; TGF-beta receptor type I; TbetaR-I] |
| Gene, Accession # | [TGFBR1], Gene ID: 7046, NCBI: NP_001124388.1, UniProt: P36897 |
| Catalog # | MBS178857 |
| Price | $280 |
| Order / More Info | TGFBR1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Drera, B., Tadini, G., Barlati, S., Colombi, M.Identification of a novel TGFBR1 mutation in a Loeys-Dietz syndrome type II patient with vascular Ehlers-Danlos syndrome phenotype. (Letter)Clin. Genet. 73: 290-293, 2008.2. Goudie, D. R., D'Alessandro, M., Merriman, B., Lee, H., Szeverenyi, I., Avery, S., O'Connor, B. D., Nelson, S. F., Coats, S. E., Stewart, A., Christie, L., Pichert, G., and 11 others.Multiple self-healing squamous epithelioma is caused by a disease-specific spectrum of mutations in TGFBR1.Nature Genet. 43: 365-369, 2011.3. Vellucci, V. F., Reiss, M.Cloning and genomic organization of the human transforming growth factor-beta type I receptor gene.Genomics 46: 278-283, 1997. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies