Edit |   |
---|---|
Antigenic Specificity | IFN Alpha 5 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: IFN Alpha 5 antibody was raised against the middle region of IFNA5. Rabbit polyclonal IFN Alpha 5 antibody raised against the middle region of IFNA5 |
Immunogen | Immunogen: IFN Alpha 5 antibody was raised using the middle region of IFNA5 corresponding to a region with amino acids TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY |
Other Names | n/a |
Gene, Accession # | [IFN Alpha 5] |
Catalog # | MBS839802 |
Price | $430 |
Order / More Info | IFN Alpha 5 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |