Edit |   |
---|---|
Antigenic Specificity | SUR1 |
Clone | N289/16 |
Host Species | Mouse |
Reactive Species | hamster, mouse, rat |
Isotype | IgG1 |
Format | FL594 conjugate |
Size | 200 µL |
Concentration | 0.5 mg/mL |
Applications | ICC, IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Mouse anti-SUR1 monoclonal antibody, FL594 conjugated. Does not cross-react with SUR2B (based on KO validation results). RRID: AB_2939962 |
Immunogen | Fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1 (accession number Q09429) produced recombinantly in E. Coli |
Other Names | ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1) |
Gene, Accession # | Abcc8 Sur Sur1, UniProt: Q09429 |
Catalog # | 75-267-FL594 |
Price | $460 |
Order / More Info | SUR1 Antibody from NEUROMAB |
Product Specific References | n/a |