Edit |   |
---|---|
Antigenic Specificity | ARD1 |
Clone | polyclonal |
Host Species | Goat |
Reactive Species | Archeoprepona genus |
Isotype | n/a |
Format | epitope affinity purified |
Size | 200 µg |
Concentration | 2 mg/ml |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | RRID: AB_2895373. Goat polyclonal antibody to Chain A defensin ARD1. This peptide isolated from one-spotted leafwing butterfly and moth has been shown to have antimicrobial properties. Using the recombinant ARD1 gives a positive signal by Western blot. Due to high homology it is likely to recognise heliomycin |
Immunogen | Purified recombinant defensin ARD1 (MDKLIGSCVWGAVNYTSNCRAECKRRGYKGGHCGSFANVNCWCET) produced in E. coli |
Other Names | Heliomycin, ETD135, ETD151 antibody. |
Gene, Accession # | n/a |
Catalog # | AB0276-100 |
Price | 320 € |
Order / More Info | ARD1 Antibody from SICGEN ANTIBODIES |
Product Specific References | n/a |