Edit |   |
---|---|
Product Name | West Nile Virus Pre-M Recombinant Protein |
Description | Purity > 95% (by SDS-PAGE). Description: The E Coli derived 20 kDa recombinant protein contains the West-Nile N-terminal Pre-M Virus immunodominant regions (MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRAMDVGYLCEDTIT YECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTH GESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE). The protein is fused with 6x His tag at C-terminal. Introduction: West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopy reveal a 45-50 nm virion covered with a relatively smooth protein surface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, s |
Size | 0.05 mg |
Concentration | n/a |
Applications | Western Blot (WB), ELISA (EIA) |
Other Names | n/a |
Gene, Accession, CAS # | n/a |
Catalog # | MBS434131 |
Price | $320 |
Order / More Info | West Nile Virus Pre-M Recombinant Protein from MYBIOSOURCE INC. |
Product Specific References | n/a |